PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12006_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 336aa    MW: 36810.2 Da    PI: 8.9128
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12006_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.4e-41171248178
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rr
  cra_locus_12006_iso_1_len_1556_ver_3 171 RCQAEGCNADLTNAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRR 243
                                           6************************************************************************ PP

                                           -S--- CS
                                   SBP  74 rkkqa 78 
                                           rk+q+
  cra_locus_12006_iso_1_len_1556_ver_3 244 RKSQQ 248
                                           **997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-35167233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.47169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-38170250IPR004333Transcription factor, SBP-box
PfamPF031103.6E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MFTTGEETSQ EAVDQNRHLF DPYATQTFNE TTALLNPNAA HFSTAHNPHH LFHHDPQSSN  60
HAHLNSLYDP RSAAAAAAAY GTSSYGHPNP HHHHHHNQTS MLSLESAGPT GYMVVPKTEP  120
ALVGALDFTN SGRIGLNLGG RTYFSSSEDD FVSRLYRRSR VAEPGSLNSP RCQAEGCNAD  180
LTNAKHYHRR HKVCEFHSKA ATVIAAGLTQ RFCQQCSRFH LLSEFDNGKR SCRKRLADHN  240
RRRRKSQQQQ QVSSSQDLSC NNKSQNDVAP NSSPHNLSRS PPESSSGGAH SSSVTVAISP  300
PRISLDCFRQ RSYHHGAAAA ATNSSASTSS LFFSNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30165245484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.11e-127PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL38e-76SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A068UMK91e-142A0A068UMK9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000749761e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341